pdb-structure

Query the RCSB PDB API for protein 3D structures, experimental metadata, and structure files. Use when the user needs crystal or cryo-EM structure data, PDB entries, resolution info, or structure file downloads. NOT for protein sequences/annotations (use UniProt), gene data (use NCBI), or pathway info (use KEGG).

564 stars

Best use case

pdb-structure is best used when you need a repeatable AI agent workflow instead of a one-off prompt.

Query the RCSB PDB API for protein 3D structures, experimental metadata, and structure files. Use when the user needs crystal or cryo-EM structure data, PDB entries, resolution info, or structure file downloads. NOT for protein sequences/annotations (use UniProt), gene data (use NCBI), or pathway info (use KEGG).

Teams using pdb-structure should expect a more consistent output, faster repeated execution, less prompt rewriting.

When to use this skill

  • You want a reusable workflow that can be run more than once with consistent structure.

When not to use this skill

  • You only need a quick one-off answer and do not need a reusable workflow.
  • You cannot install or maintain the underlying files, dependencies, or repository context.

Installation

Claude Code / Cursor / Codex

$curl -o ~/.claude/skills/pdb-structure/SKILL.md --create-dirs "https://raw.githubusercontent.com/beita6969/ScienceClaw/main/skills/pdb-structure/SKILL.md"

Manual Installation

  1. Download SKILL.md from GitHub
  2. Place it in .claude/skills/pdb-structure/SKILL.md inside your project
  3. Restart your AI agent — it will auto-discover the skill

How pdb-structure Compares

Feature / Agentpdb-structureStandard Approach
Platform SupportNot specifiedLimited / Varies
Context Awareness High Baseline
Installation ComplexityUnknownN/A

Frequently Asked Questions

What does this skill do?

Query the RCSB PDB API for protein 3D structures, experimental metadata, and structure files. Use when the user needs crystal or cryo-EM structure data, PDB entries, resolution info, or structure file downloads. NOT for protein sequences/annotations (use UniProt), gene data (use NCBI), or pathway info (use KEGG).

Where can I find the source code?

You can find the source code on GitHub using the link provided at the top of the page.

SKILL.md Source

# RCSB Protein Data Bank (PDB) API

Access the RCSB PDB to search, retrieve, and download macromolecular 3D structures.
Covers X-ray crystallography, cryo-EM, NMR, and other experimental methods. No authentication required.

## API Endpoints

Data API Base: `https://data.rcsb.org`
Search API Base: `https://search.rcsb.org`
File Downloads: `https://files.rcsb.org`

### GET /rest/v1/core/entry/{pdb_id} -- Structure metadata
```bash
# Get full metadata for a PDB entry (human hemoglobin)
curl -s "https://data.rcsb.org/rest/v1/core/entry/1HBB"

# Get entry metadata for SARS-CoV-2 spike protein structure
curl -s "https://data.rcsb.org/rest/v1/core/entry/6VYB"
```

### POST /rcsbsearch/v2/query -- Advanced search API
```bash
# Search by text (protein name)
curl -s -X POST "https://search.rcsb.org/rcsbsearch/v2/query" \
  -H "Content-Type: application/json" \
  -d '{
    "query": {
      "type": "terminal",
      "service": "full_text",
      "parameters": { "value": "insulin receptor" }
    },
    "return_type": "entry",
    "request_options": { "paginate": { "start": 0, "rows": 10 } }
  }'

# Search by organism and resolution
curl -s -X POST "https://search.rcsb.org/rcsbsearch/v2/query" \
  -H "Content-Type: application/json" \
  -d '{
    "query": {
      "type": "group",
      "logical_operator": "and",
      "nodes": [
        {
          "type": "terminal",
          "service": "text",
          "parameters": {
            "attribute": "rcsb_entity_source_organism.ncbi_scientific_name",
            "operator": "exact_match",
            "value": "Homo sapiens"
          }
        },
        {
          "type": "terminal",
          "service": "text",
          "parameters": {
            "attribute": "rcsb_entry_info.resolution_combined",
            "operator": "less",
            "value": 2.0
          }
        }
      ]
    },
    "return_type": "entry",
    "request_options": { "paginate": { "start": 0, "rows": 10 } }
  }'

# Search by sequence similarity (BLAST-like)
curl -s -X POST "https://search.rcsb.org/rcsbsearch/v2/query" \
  -H "Content-Type: application/json" \
  -d '{
    "query": {
      "type": "terminal",
      "service": "sequence",
      "parameters": {
        "evalue_cutoff": 0.001,
        "identity_cutoff": 0.9,
        "sequence_type": "protein",
        "value": "MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSH"
      }
    },
    "return_type": "polymer_entity",
    "request_options": { "paginate": { "start": 0, "rows": 10 } }
  }'
```

### File Downloads -- Structure coordinate files
```bash
# Download PDB format file
curl -s "https://files.rcsb.org/download/1HBB.pdb" -o 1HBB.pdb

# Download mmCIF format file
curl -s "https://files.rcsb.org/download/1HBB.cif" -o 1HBB.cif

# Download structure factors (X-ray data)
curl -s "https://files.rcsb.org/download/1HBB-sf.cif" -o 1HBB-sf.cif
```

### GraphQL API -- Flexible data queries
```bash
# Query specific fields via GraphQL
curl -s -X POST "https://data.rcsb.org/graphql" \
  -H "Content-Type: application/json" \
  -d '{
    "query": "{ entry(entry_id: \"1HBB\") { rcsb_entry_info { resolution_combined experimental_method } struct { title } rcsb_accession_info { deposit_date } } }"
  }'
```

## Best Practices

1. Use the search API (POST) for complex queries; use the data API (GET) for known PDB IDs.
2. Always check `resolution_combined` to assess structure quality -- lower is better.
3. Use mmCIF format (`.cif`) over legacy PDB format for modern structures with large assemblies.
4. Sequence search is useful for finding structures of homologous proteins.
5. No authentication is required, but keep request volume reasonable.
6. PDB IDs are 4 characters (e.g., 1HBB). New extended IDs (PDB-xxxxx) are also supported.
7. Use GraphQL for retrieving only the specific fields you need.

## Data Integrity Rule

NEVER fabricate database results from training data. Every protein ID, gene name, compound property, pathway ID, structure detail, and metadata MUST come from an actual API response in this conversation. If the API returns no results, errors, or partial data, report exactly what happened. Do not "fill in" missing data from memory or make up identifiers.

Related Skills

protein-structure

564
from beita6969/ScienceClaw

Analyzes protein 3D structures, performs homology modeling, interprets AlphaFold predictions, conducts molecular docking, and evaluates protein-ligand interactions; trigger when users ask about PDB files, folding, binding sites, or structural biology.

protein-structure-prediction

564
from beita6969/ScienceClaw

COPYRIGHT NOTICE

xurl

564
from beita6969/ScienceClaw

A CLI tool for making authenticated requests to the X (Twitter) API. Use this skill when you need to post tweets, reply, quote, search, read posts, manage followers, send DMs, upload media, or interact with any X API v2 endpoint.

xlsx

564
from beita6969/ScienceClaw

Use this skill any time a spreadsheet file is the primary input or output. This means any task where the user wants to: open, read, edit, or fix an existing .xlsx, .xlsm, .csv, or .tsv file (e.g., adding columns, computing formulas, formatting, charting, cleaning messy data); create a new spreadsheet from scratch or from other data sources; or convert between tabular file formats. Trigger especially when the user references a spreadsheet file by name or path — even casually (like "the xlsx in my downloads") — and wants something done to it or produced from it. Also trigger for cleaning or restructuring messy tabular data files (malformed rows, misplaced headers, junk data) into proper spreadsheets. The deliverable must be a spreadsheet file. Do NOT trigger when the primary deliverable is a Word document, HTML report, standalone Python script, database pipeline, or Google Sheets API integration, even if tabular data is involved.

writing

564
from beita6969/ScienceClaw

No description provided.

world-bank-data

564
from beita6969/ScienceClaw

World Bank Open Data API for development indicators. Use when: user asks about GDP, population, poverty, health, or education statistics by country. NOT for: real-time financial data or stock prices.

wikipedia-search

564
from beita6969/ScienceClaw

Search and fetch structured content from Wikipedia using the MediaWiki API for reliable, encyclopedic information

wikidata-knowledge

564
from beita6969/ScienceClaw

Query Wikidata for structured knowledge using SPARQL and entity search. Use when: (1) finding structured facts about entities (people, places, organizations), (2) querying relationships between entities, (3) cross-referencing external identifiers (Wikipedia, VIAF, GND, ORCID), (4) building knowledge graphs from linked data. NOT for: full-text article content (use Wikipedia API), scientific literature (use semantic-scholar), geospatial data (use OpenStreetMap).

weather

564
from beita6969/ScienceClaw

Get current weather and forecasts via wttr.in or Open-Meteo. Use when: user asks about weather, temperature, or forecasts for any location. NOT for: historical weather data, severe weather alerts, or detailed meteorological analysis. No API key needed.

wacli

564
from beita6969/ScienceClaw

Send WhatsApp messages to other people or search/sync WhatsApp history via the wacli CLI (not for normal user chats).

voice-call

564
from beita6969/ScienceClaw

Start voice calls via the OpenClaw voice-call plugin.

visualization

564
from beita6969/ScienceClaw

Create publication-quality scientific figures and plots using Python (matplotlib, seaborn, plotly). Supports bar charts, scatter plots, heatmaps, box plots, violin plots, survival curves, network graphs, and more. Use when user asks to plot data, create figures, make charts, visualize results, or generate publication-ready graphics. Triggers on "plot", "chart", "figure", "graph", "visualize", "heatmap", "scatter plot", "bar chart", "histogram".