boltz2-binding-affinity
Predict protein-ligand binding affinity using Boltz-2 model to assess molecular interactions and binding probability for drug discovery.
Best use case
boltz2-binding-affinity is best used when you need a repeatable AI agent workflow instead of a one-off prompt.
Predict protein-ligand binding affinity using Boltz-2 model to assess molecular interactions and binding probability for drug discovery.
Teams using boltz2-binding-affinity should expect a more consistent output, faster repeated execution, less prompt rewriting.
When to use this skill
- You want a reusable workflow that can be run more than once with consistent structure.
When not to use this skill
- You only need a quick one-off answer and do not need a reusable workflow.
- You cannot install or maintain the underlying files, dependencies, or repository context.
Installation
Claude Code / Cursor / Codex
Manual Installation
- Download SKILL.md from GitHub
- Place it in
.claude/skills/boltz2-binding-affinity/SKILL.mdinside your project - Restart your AI agent — it will auto-discover the skill
How boltz2-binding-affinity Compares
| Feature / Agent | boltz2-binding-affinity | Standard Approach |
|---|---|---|
| Platform Support | Not specified | Limited / Varies |
| Context Awareness | High | Baseline |
| Installation Complexity | Unknown | N/A |
Frequently Asked Questions
What does this skill do?
Predict protein-ligand binding affinity using Boltz-2 model to assess molecular interactions and binding probability for drug discovery.
Where can I find the source code?
You can find the source code on GitHub using the link provided at the top of the page.
SKILL.md Source
# Boltz-2 Protein-Ligand Binding Affinity Prediction
## Usage
### 1. MCP Server Definition
```python
import asyncio
import json
from mcp.client.streamable_http import streamablehttp_client
from mcp import ClientSession
class DrugSDAClient:
"""DrugSDA-Model MCP Client"""
def __init__(self, server_url: str, api_key: str):
self.server_url = server_url
self.api_key = api_key
self.session = None
async def connect(self):
"""Establish connection and initialize session"""
print(f"server url: {self.server_url}")
try:
self.transport = streamablehttp_client(
url=self.server_url,
headers={"SCP-HUB-API-KEY": self.api_key}
)
self.read, self.write, self.get_session_id = await self.transport.__aenter__()
self.session_ctx = ClientSession(self.read, self.write)
self.session = await self.session_ctx.__aenter__()
await self.session.initialize()
session_id = self.get_session_id()
print(f"✓ connect success")
return True
except Exception as e:
print(f"✗ connect failure: {e}")
import traceback
traceback.print_exc()
return False
async def disconnect(self):
"""Disconnect from server"""
try:
if self.session:
await self.session_ctx.__aexit__(None, None, None)
if hasattr(self, 'transport'):
await self.transport.__aexit__(None, None, None)
print("✓ already disconnect")
except Exception as e:
print(f"✗ disconnect error: {e}")
def parse_result(self, result):
"""Parse MCP tool call result"""
try:
if hasattr(result, 'content') and result.content:
content = result.content[0]
if hasattr(content, 'text'):
return json.loads(content.text)
return str(result)
except Exception as e:
return {"error": f"parse error: {e}", "raw": str(result)}
```
### 2. Boltz-2 Binding Affinity Workflow
This workflow predicts protein-ligand binding affinity using the Boltz-2 deep learning model, providing affinity probabilities and 3D complex structures.
**Workflow Steps:**
1. **Prepare Input** - Define protein sequence and SMILES list for ligands
2. **Run Boltz-2 Prediction** - Calculate binding affinity probability for each ligand
3. **Analyze Results** - Extract affinity scores and structure files
**Implementation:**
```python
## Initialize client
client = DrugSDAClient(
"https://scp.intern-ai.org.cn/api/v1/mcp/3/DrugSDA-Model",
"<your-api-key>"
)
if not await client.connect():
print("connection failed")
exit()
## Input: Protein sequence and ligand SMILES
sequence = 'PIVQNLQGQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNAATETLLVQNANPDCKTILKALGPGATLEEMMTACQG'
protein = [{'chain': 'A', 'sequence': sequence}]
smiles_list = ['N[C@@H](Cc1ccc(O)cc1)C(=O)O', "CC(C)C1=CC=CC=C1"]
## Execute Boltz-2 binding affinity prediction
result = await client.session.call_tool(
"boltz_binding_affinity",
arguments={
"protein": protein,
"smiles_list": smiles_list
}
)
result_data = client.parse_result(result)
boltz_res = result_data["boltz_res"]
## Display results
for i, item in enumerate(boltz_res, 1):
print(f"{i}. SMILES: {item['smiles']}")
print(f" Affinity Probability: {item['affinity_probability']:.4f}")
print(f" Structure File: {item['cif_file']}\n")
await client.disconnect()
```
### Tool Descriptions
**DrugSDA-Model Server:**
- `boltz_binding_affinity`: Predict protein-ligand binding affinity using Boltz-2
- Args:
- `protein` (list): List of protein chains with sequence information
- Each chain: `{'chain': str, 'sequence': str}`
- `smiles_list` (list): List of ligand SMILES strings
- Returns:
- `boltz_res` (list): List of binding predictions
- `smiles` (str): Ligand SMILES string
- `affinity_probability` (float): Binding affinity probability (0-1)
- `cif_file` (str): Path to predicted complex structure
### Input/Output
**Input:**
- `protein`: List of protein chains
- `chain`: Chain identifier (e.g., 'A', 'B')
- `sequence`: Amino acid sequence in single-letter code
- `smiles_list`: List of SMILES strings for ligand molecules
**Output:**
- List of binding predictions, each containing:
- `smiles`: Ligand SMILES string
- `affinity_probability`: Binding probability (0-1, higher is better)
- `cif_file`: Path to predicted protein-ligand complex structure in CIF format
### Affinity Interpretation
- **Probability > 0.5**: Strong binding likelihood
- **Probability 0.3-0.5**: Moderate binding potential
- **Probability < 0.3**: Weak or no binding expected
### Use Cases
- Virtual screening of compound libraries
- Lead optimization in drug discovery
- Protein-ligand binding mode prediction
- Structure-based drug design
- Comparative binding analysis across ligands
### Performance Notes
- **Execution time**: 30-120 seconds per ligand depending on protein size
- **Protein length**: Best for proteins <1000 amino acids
- **Multiple ligands**: Processes sequentially, allow sufficient time
- **Structure output**: CIF files can be visualized in PyMOL, ChimeraX, or similar toolsRelated Skills
binding_site_characterization
Binding Site Characterization - Characterize binding sites: predict pockets with fpocket and P2Rank, get binding site info from ChEMBL, and visualize. Use this skill for structural biology tasks involving run fpocket pred pocket prank get binding site by id visualize protein. Combines 4 tools from 3 SCP server(s).
affinity_maturation
Affinity Maturation Pipeline - Affinity maturation: compute binding affinity, predict mutations, compute hydrophilicity, and predict drug-target interaction. Use this skill for antibody engineering tasks involving ComputeAffinityCalculator zero shot sequence prediction ComputeHydrophilicity PredictDrugTargetInteraction. Combines 4 tools from 3 SCP server(s).
acpx
Use the ACPX CLI through DrClaw's existing exec/long_exec tools to run Codex in the current project workspace.
ui-ux-pro-max
[Frontend] Frontend UI/UX design intelligence - activate FIRST when user requests beautiful, stunning, gorgeous, or aesthetic interfaces. 50 styles, 21 palettes, 50 font pairings, 20 charts, 8 stacks. Triggers on ui design, ux design, design system, color palette, typography, glassmorphism, claymorphism, neumorphism, bento grid, font pairing, ui-ux-pro-max, stunning interface, beautiful ui.
fetch
Fetch metadata and links from arXiv for a given query.
web_literature_mining
Scientific Literature Mining - Mine scientific literature: PubMed search, arXiv search, web search, and Tavily deep search. Use this skill for scientific informatics tasks involving pubmed search search literature search web tavily search. Combines 4 tools from 2 SCP server(s).
uniprot_deep_analysis
UniProt Deep Protein Analysis - Deep UniProt analysis: entry data, UniRef clusters, UniParc cross-references, and gene-centric view. Use this skill for protein science tasks involving get uniprotkb entry by accession get uniref cluster by id get uniparc entry by upi get gene centric by accession. Combines 4 tools from 1 SCP server(s).
synthetic_biology_design
Synthetic Biology Design - Design synthetic biology construct: gene lookup, codon optimization, protein property prediction, and structure prediction. Use this skill for synthetic biology tasks involving get sequence id DegenerateCodonCalculatorbyAminoAcid calculate protein sequence properties pred protein structure esmfold. Combines 4 tools from 4 SCP server(s).
structural_homology_modeling
Structural Homology & Evolution Analysis - Analyze protein evolution: get gene tree from Ensembl, find homologs, compare sequences, and predict structure. Use this skill for evolutionary biology tasks involving get homology symbol get genetree member symbol calculate protein sequence properties pred protein structure esmfold. Combines 4 tools from 3 SCP server(s).
proteome_analysis
Proteome-Level Analysis - Analyze at proteome level: get proteome from UniProt, gene-centric view, functional annotation from STRING. Use this skill for proteomics tasks involving get proteome by id get gene centric by proteome get functional annotation. Combines 3 tools from 2 SCP server(s).
protein_structure_analysis
Protein Structure Comprehensive Analysis - Comprehensive structure analysis: download PDB, extract chains, calculate geometry, quality metrics, and composition. Use this skill for structural biology tasks involving retrieve protein data by pdbcode extract pdb chains calculate pdb structural geometry calculate pdb quality metrics calculate pdb composition info. Combines 5 tools from 1 SCP server(s).
protein_solubility_optimization
Protein Solubility Optimization - Optimize protein solubility: calculate properties, predict solubility, predict hydrophilicity, and suggest mutations. Use this skill for protein engineering tasks involving calculate protein sequence properties predict protein function ComputeHydrophilicity zero shot sequence prediction. Combines 4 tools from 3 SCP server(s).