tooluniverse-protein-therapeutic-design
Design novel protein therapeutics (binders, enzymes, scaffolds) using AI-guided de novo design. Uses RFdiffusion for backbone generation, ProteinMPNN for sequence design, ESMFold/AlphaFold2 for validation. Use when asked to design protein binders, therapeutic proteins, or engineer protein function.
Best use case
tooluniverse-protein-therapeutic-design is best used when you need a repeatable AI agent workflow instead of a one-off prompt.
Design novel protein therapeutics (binders, enzymes, scaffolds) using AI-guided de novo design. Uses RFdiffusion for backbone generation, ProteinMPNN for sequence design, ESMFold/AlphaFold2 for validation. Use when asked to design protein binders, therapeutic proteins, or engineer protein function.
Teams using tooluniverse-protein-therapeutic-design should expect a more consistent output, faster repeated execution, less prompt rewriting.
When to use this skill
- You want a reusable workflow that can be run more than once with consistent structure.
When not to use this skill
- You only need a quick one-off answer and do not need a reusable workflow.
- You cannot install or maintain the underlying files, dependencies, or repository context.
Installation
Claude Code / Cursor / Codex
Manual Installation
- Download SKILL.md from GitHub
- Place it in
.claude/skills/tooluniverse-protein-therapeutic-design/SKILL.mdinside your project - Restart your AI agent — it will auto-discover the skill
How tooluniverse-protein-therapeutic-design Compares
| Feature / Agent | tooluniverse-protein-therapeutic-design | Standard Approach |
|---|---|---|
| Platform Support | Not specified | Limited / Varies |
| Context Awareness | High | Baseline |
| Installation Complexity | Unknown | N/A |
Frequently Asked Questions
What does this skill do?
Design novel protein therapeutics (binders, enzymes, scaffolds) using AI-guided de novo design. Uses RFdiffusion for backbone generation, ProteinMPNN for sequence design, ESMFold/AlphaFold2 for validation. Use when asked to design protein binders, therapeutic proteins, or engineer protein function.
Where can I find the source code?
You can find the source code on GitHub using the link provided at the top of the page.
SKILL.md Source
# Therapeutic Protein Designer
AI-guided de novo protein design using RFdiffusion backbone generation, ProteinMPNN sequence optimization, and structure validation for therapeutic protein development.
**KEY PRINCIPLES**:
1. **Structure-first design** - Generate backbone geometry before sequence
2. **Target-guided** - Design binders with target structure in mind
3. **Iterative validation** - Predict structure to validate designs
4. **Developability-aware** - Consider aggregation, immunogenicity, expression
5. **Evidence-graded** - Grade designs by confidence metrics
6. **Actionable output** - Provide sequences ready for experimental testing
7. **English-first queries** - Always use English terms in tool calls (protein names, target names), even if the user writes in another language. Only try original-language terms as a fallback. Respond in the user's language
---
## When to Use
Apply when user asks:
- "Design a protein binder for [target]"
- "Create a therapeutic protein against [protein/epitope]"
- "Design a protein scaffold with [property]"
- "Optimize this protein sequence for [function]"
- "Design a de novo enzyme for [reaction]"
- "Generate protein variants for [target binding]"
---
## Critical Workflow Requirements
### 1. Report-First Approach (MANDATORY)
1. **Create the report file FIRST**:
- File name: `[TARGET]_protein_design_report.md`
- Initialize with section headers
- Add placeholder: `[Designing...]`
2. **Progressively update** as designs are generated
3. **Output separate files**:
- `[TARGET]_designed_sequences.fasta` - All designed sequences
- `[TARGET]_top_candidates.csv` - Ranked candidates with metrics
### 2. Design Documentation (MANDATORY)
Every design MUST include:
```markdown
### Design: Binder_001
**Sequence**: MVLSPADKTN...
**Length**: 85 amino acids
**Target**: PD-L1 (UniProt: Q9NZQ7)
**Method**: RFdiffusion → ProteinMPNN → ESMFold validation
**Quality Metrics**:
| Metric | Value | Interpretation |
|--------|-------|----------------|
| pLDDT | 88.5 | High confidence |
| pTM | 0.82 | Good fold |
| ProteinMPNN score | -2.3 | Favorable |
| Predicted binding | Strong | Based on interface pLDDT |
*Source: NVIDIA NIM via `NvidiaNIM_rfdiffusion`, `NvidiaNIM_proteinmpnn`, `NvidiaNIM_esmfold`*
```
---
## Phase 0: Tool Verification
### NVIDIA NIM Tools Required
| Tool | Purpose | API Key Required |
|------|---------|------------------|
| `NvidiaNIM_rfdiffusion` | Backbone generation | Yes |
| `NvidiaNIM_proteinmpnn` | Sequence design | Yes |
| `NvidiaNIM_esmfold` | Fast structure validation | Yes |
| `NvidiaNIM_alphafold2` | High-accuracy validation | Yes |
| `NvidiaNIM_esm2_650m` | Sequence embeddings | Yes |
### Parameter Verification
| Tool | WRONG Parameter | CORRECT Parameter |
|------|-----------------|-------------------|
| `NvidiaNIM_rfdiffusion` | `num_steps` | `diffusion_steps` |
| `NvidiaNIM_proteinmpnn` | `pdb` | `pdb_string` |
| `NvidiaNIM_esmfold` | `seq` | `sequence` |
---
## Workflow Overview
```
Phase 1: Target Characterization
├── Get target structure (PDB, EMDB cryo-EM, or AlphaFold)
├── Identify binding epitope
├── Analyze existing binders
├── Check EMDB for membrane protein structures (NEW)
└── OUTPUT: Target profile
↓
Phase 2: Backbone Generation (RFdiffusion)
├── Define design constraints
├── Generate multiple backbones
├── Filter by geometry quality
└── OUTPUT: Candidate backbones
↓
Phase 3: Sequence Design (ProteinMPNN)
├── Design sequences for each backbone
├── Sample multiple sequences per backbone
├── Score by ProteinMPNN likelihood
└── OUTPUT: Designed sequences
↓
Phase 4: Structure Validation
├── Predict structure (ESMFold/AlphaFold2)
├── Compare to designed backbone
├── Assess fold quality (pLDDT, pTM)
└── OUTPUT: Validated designs
↓
Phase 5: Developability Assessment
├── Aggregation propensity
├── Expression likelihood
├── Immunogenicity prediction
└── OUTPUT: Developability scores
↓
Phase 6: Report Synthesis
├── Ranked candidate list
├── Experimental recommendations
├── Next steps
└── OUTPUT: Final report
```
---
## Phase 1: Target Characterization
### 1.1 Get Target Structure
```python
def get_target_structure(tu, target_id):
"""Get target structure from PDB, EMDB, or predict."""
# Try PDB first (X-ray/NMR)
pdb_results = tu.tools.PDB_search_by_uniprot(uniprot_id=target_id)
if pdb_results:
# Get highest resolution structure
best_pdb = sorted(pdb_results, key=lambda x: x['resolution'])[0]
structure = tu.tools.PDB_get_structure(pdb_id=best_pdb['pdb_id'])
return {'source': 'PDB', 'pdb_id': best_pdb['pdb_id'],
'resolution': best_pdb['resolution'], 'structure': structure}
# Try EMDB for cryo-EM structures (valuable for membrane proteins)
protein_info = tu.tools.UniProt_get_protein_by_accession(accession=target_id)
emdb_results = tu.tools.emdb_search(
query=protein_info['proteinDescription']['recommendedName']['fullName']['value']
)
if emdb_results and len(emdb_results) > 0:
# Get highest resolution cryo-EM entry
best_emdb = sorted(emdb_results, key=lambda x: x.get('resolution', 99))[0]
# Get associated PDB model if available
emdb_details = tu.tools.emdb_get_entry(entry_id=best_emdb['emdb_id'])
if emdb_details.get('pdb_ids'):
structure = tu.tools.PDB_get_structure(pdb_id=emdb_details['pdb_ids'][0])
return {'source': 'EMDB cryo-EM', 'emdb_id': best_emdb['emdb_id'],
'pdb_id': emdb_details['pdb_ids'][0],
'resolution': best_emdb.get('resolution'), 'structure': structure}
# Fallback to AlphaFold prediction
sequence = tu.tools.UniProt_get_protein_sequence(accession=target_id)
structure = tu.tools.NvidiaNIM_alphafold2(
sequence=sequence['sequence'],
algorithm="mmseqs2"
)
return {'source': 'AlphaFold2 (predicted)', 'structure': structure}
```
### 1.1b EMDB for Membrane Proteins (NEW)
**When to prioritize EMDB**: Membrane proteins, large complexes, and targets where conformational states matter.
```python
def get_cryoem_structures(tu, target_name):
"""Get cryo-EM structures for membrane proteins/complexes."""
# Search EMDB
emdb_results = tu.tools.emdb_search(
query=f"{target_name} membrane OR receptor"
)
structures = []
for entry in emdb_results[:5]:
details = tu.tools.emdb_get_entry(entry_id=entry['emdb_id'])
structures.append({
'emdb_id': entry['emdb_id'],
'resolution': entry.get('resolution', 'N/A'),
'title': entry.get('title', 'N/A'),
'conformational_state': details.get('state', 'Unknown'),
'pdb_models': details.get('pdb_ids', [])
})
return structures
```
**Output for Report**:
```markdown
### 1.1b Cryo-EM Structures (EMDB)
| EMDB ID | Resolution | PDB Model | Conformation |
|---------|------------|-----------|--------------|
| EMD-12345 | 2.8 Å | 7ABC | Active state |
| EMD-23456 | 3.1 Å | 8DEF | Inactive state |
**Note**: Cryo-EM structures capture physiologically relevant conformations for membrane protein targets.
*Source: EMDB*
```
### 1.2 Identify Binding Epitope
```python
def identify_epitope(tu, target_structure, epitope_residues=None):
"""Identify or validate binding epitope."""
if epitope_residues:
# User-specified epitope
return {'residues': epitope_residues, 'source': 'user-defined'}
# Find surface-exposed regions
# Use structural analysis to identify potential epitopes
return analyze_surface(target_structure)
```
### 1.3 Output for Report
```markdown
## 1. Target Characterization
### 1.1 Target Information
| Property | Value |
|----------|-------|
| **Target** | PD-L1 (Programmed death-ligand 1) |
| **UniProt** | Q9NZQ7 |
| **Structure source** | PDB: 4ZQK (2.0 Å resolution) |
| **Binding epitope** | IgV domain, residues 19-127 |
| **Known binders** | Atezolizumab, durvalumab, avelumab |
### 1.2 Epitope Analysis
| Residue Range | Type | Surface Area | Druggability |
|---------------|------|--------------|--------------|
| 54-68 | Loop | 850 Ų | High |
| 115-125 | Beta strand | 420 Ų | Medium |
| 19-30 | N-terminus | 380 Ų | Medium |
**Selected Epitope**: Residues 54-68 (PD-1 binding interface)
*Source: PDB 4ZQK, surface analysis*
```
---
## Phase 2: Backbone Generation
### 2.1 RFdiffusion Design
```python
def generate_backbones(tu, design_params):
"""Generate de novo backbones using RFdiffusion."""
backbones = tu.tools.NvidiaNIM_rfdiffusion(
diffusion_steps=design_params.get('steps', 50),
# Additional parameters depending on design type
)
return backbones
```
### 2.2 Design Modes
| Mode | Use Case | Key Parameters |
|------|----------|----------------|
| **Unconditional** | De novo scaffold | `diffusion_steps` only |
| **Binder design** | Target-guided binder | `target_structure`, `hotspot_residues` |
| **Motif scaffolding** | Functional motif embedding | `motif_sequence`, `motif_structure` |
### 2.3 Output for Report
```markdown
## 2. Backbone Generation
### 2.1 Design Parameters
| Parameter | Value |
|-----------|-------|
| **Method** | RFdiffusion via NVIDIA NIM |
| **Design mode** | Unconditional scaffold generation |
| **Diffusion steps** | 50 |
| **Number generated** | 10 backbones |
### 2.2 Generated Backbones
| Backbone | Length | Topology | Quality |
|----------|--------|----------|---------|
| BB_001 | 85 aa | 3-helix bundle | Good |
| BB_002 | 92 aa | Beta sandwich | Good |
| BB_003 | 78 aa | Alpha-beta | Good |
| BB_004 | 88 aa | All-alpha | Moderate |
| BB_005 | 95 aa | Mixed | Good |
**Selected for sequence design**: BB_001, BB_002, BB_003, BB_005 (top 4)
*Source: NVIDIA NIM via `NvidiaNIM_rfdiffusion`*
```
---
## Phase 3: Sequence Design
### 3.1 ProteinMPNN Design
```python
def design_sequences(tu, backbone_pdb, num_sequences=8):
"""Design sequences for backbone using ProteinMPNN."""
sequences = tu.tools.NvidiaNIM_proteinmpnn(
pdb_string=backbone_pdb,
num_sequences=num_sequences,
temperature=0.1 # Lower = more conservative
)
return sequences
```
### 3.2 Sampling Parameters
| Parameter | Conservative | Moderate | Diverse |
|-----------|--------------|----------|---------|
| Temperature | 0.1 | 0.2 | 0.5 |
| Sequences per backbone | 4 | 8 | 16 |
| Use case | Validated scaffold | Exploration | Diversity |
### 3.3 Output for Report
```markdown
## 3. Sequence Design
### 3.1 Design Parameters
| Parameter | Value |
|-----------|-------|
| **Method** | ProteinMPNN via NVIDIA NIM |
| **Temperature** | 0.1 (conservative) |
| **Sequences per backbone** | 8 |
| **Total sequences** | 32 |
### 3.2 Designed Sequences (Top 10 by Score)
| Rank | Backbone | Sequence ID | Length | MPNN Score | Predicted pI |
|------|----------|-------------|--------|------------|--------------|
| 1 | BB_001 | Seq_001_A | 85 | -1.89 | 6.2 |
| 2 | BB_002 | Seq_002_C | 92 | -1.95 | 5.8 |
| 3 | BB_001 | Seq_001_B | 85 | -2.01 | 7.1 |
| 4 | BB_003 | Seq_003_A | 78 | -2.08 | 6.5 |
| 5 | BB_005 | Seq_005_B | 95 | -2.12 | 5.4 |
### 3.3 Top Sequence: Seq_001_A
```
>Seq_001_A (85 aa, MPNN score: -1.89)
MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSH
GSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKL
```
*Source: NVIDIA NIM via `NvidiaNIM_proteinmpnn`*
```
---
## Phase 4: Structure Validation
### 4.1 ESMFold Validation
```python
def validate_structure(tu, sequence):
"""Validate designed sequence by structure prediction."""
# Fast validation with ESMFold
predicted = tu.tools.NvidiaNIM_esmfold(sequence=sequence)
# Extract quality metrics
plddt = extract_plddt(predicted)
ptm = extract_ptm(predicted)
return {
'structure': predicted,
'mean_plddt': np.mean(plddt),
'ptm': ptm,
'passes': np.mean(plddt) > 70 and ptm > 0.7
}
```
### 4.2 Validation Criteria
| Metric | Threshold | Interpretation |
|--------|-----------|----------------|
| Mean pLDDT | >70 | Confident fold |
| pTM | >0.7 | Good global topology |
| RMSD to backbone | <2 Å | Design recapitulated |
### 4.3 Output for Report
```markdown
## 4. Structure Validation
### 4.1 Validation Results
| Sequence | pLDDT | pTM | RMSD to Design | Status |
|----------|-------|-----|----------------|--------|
| Seq_001_A | 88.5 | 0.85 | 1.2 Å | ✓ PASS |
| Seq_002_C | 82.3 | 0.79 | 1.5 Å | ✓ PASS |
| Seq_001_B | 85.1 | 0.82 | 1.3 Å | ✓ PASS |
| Seq_003_A | 79.8 | 0.76 | 1.8 Å | ✓ PASS |
| Seq_005_B | 68.2 | 0.65 | 2.8 Å | ✗ FAIL |
### 4.2 Top Validated Design: Seq_001_A
| Region | Residues | pLDDT | Interpretation |
|--------|----------|-------|----------------|
| Helix 1 | 1-28 | 92.3 | Very high confidence |
| Loop 1 | 29-35 | 78.4 | Moderate confidence |
| Helix 2 | 36-58 | 91.8 | Very high confidence |
| Loop 2 | 59-65 | 75.2 | Moderate confidence |
| Helix 3 | 66-85 | 90.1 | Very high confidence |
**Overall**: Well-folded 3-helix bundle with high confidence core
*Source: NVIDIA NIM via `NvidiaNIM_esmfold`*
```
---
## Phase 5: Developability Assessment
### 5.1 Aggregation Propensity
```python
def assess_aggregation(sequence):
"""Assess aggregation propensity."""
# Calculate hydrophobic patches
# Calculate isoelectric point
# Identify aggregation-prone motifs
return {
'aggregation_score': score,
'hydrophobic_patches': patches,
'risk_level': 'Low' if score < 0.5 else 'Medium' if score < 0.7 else 'High'
}
```
### 5.2 Developability Metrics
| Metric | Favorable | Marginal | Unfavorable |
|--------|-----------|----------|-------------|
| Aggregation score | <0.5 | 0.5-0.7 | >0.7 |
| Isoelectric point | 5-9 | 4-5 or 9-10 | <4 or >10 |
| Hydrophobic patches | <3 | 3-5 | >5 |
| Cysteine count | 0 or even | Odd | Multiple unpaired |
### 5.3 Output for Report
```markdown
## 5. Developability Assessment
### 5.1 Developability Scores
| Design | Aggregation | pI | Cysteines | Expression | Overall |
|--------|-------------|-----|-----------|------------|---------|
| Seq_001_A | 0.32 (Low) | 6.2 | 0 | High | ★★★ |
| Seq_002_C | 0.45 (Low) | 5.8 | 2 (paired) | Medium | ★★☆ |
| Seq_001_B | 0.38 (Low) | 7.1 | 0 | High | ★★★ |
| Seq_003_A | 0.58 (Med) | 6.5 | 0 | Medium | ★★☆ |
### 5.2 Recommendations
**Best candidate for expression**: Seq_001_A
- Low aggregation propensity
- Neutral pI (easy purification)
- No cysteines (no misfolding risk)
- Predicted high E. coli expression
*Source: Sequence analysis*
```
---
## Report Template
```markdown
# Therapeutic Protein Design Report: [TARGET]
**Generated**: [Date] | **Query**: [Original query] | **Status**: In Progress
---
## Executive Summary
[Designing...]
---
## 1. Target Characterization
### 1.1 Target Information
[Designing...]
### 1.2 Binding Epitope
[Designing...]
---
## 2. Backbone Generation
### 2.1 Design Parameters
[Designing...]
### 2.2 Generated Backbones
[Designing...]
---
## 3. Sequence Design
### 3.1 ProteinMPNN Results
[Designing...]
### 3.2 Top Sequences
[Designing...]
---
## 4. Structure Validation
### 4.1 ESMFold Validation
[Designing...]
### 4.2 Quality Metrics
[Designing...]
---
## 5. Developability Assessment
### 5.1 Scores
[Designing...]
### 5.2 Recommendations
[Designing...]
---
## 6. Final Candidates
### 6.1 Ranked List
[Designing...]
### 6.2 Sequences for Testing
[Designing...]
---
## 7. Experimental Recommendations
[Designing...]
---
## 8. Data Sources
[Will be populated...]
```
---
## Evidence Grading
| Tier | Symbol | Criteria |
|------|--------|----------|
| **T1** | ★★★ | pLDDT >85, pTM >0.8, low aggregation, neutral pI |
| **T2** | ★★☆ | pLDDT >75, pTM >0.7, acceptable developability |
| **T3** | ★☆☆ | pLDDT >70, pTM >0.65, developability concerns |
| **T4** | ☆☆☆ | Failed validation or major developability issues |
---
## Completeness Checklist
### Phase 1: Target
- [ ] Target structure obtained (PDB or predicted)
- [ ] Binding epitope identified
- [ ] Existing binders noted
### Phase 2: Backbones
- [ ] ≥5 backbones generated
- [ ] Top 3-5 selected for sequence design
- [ ] Selection criteria documented
### Phase 3: Sequences
- [ ] ≥8 sequences per backbone designed
- [ ] MPNN scores reported
- [ ] Top 10 sequences listed
### Phase 4: Validation
- [ ] All sequences validated by ESMFold
- [ ] pLDDT and pTM reported
- [ ] Pass/fail criteria applied
- [ ] ≥3 passing designs
### Phase 5: Developability
- [ ] Aggregation assessed
- [ ] pI calculated
- [ ] Expression prediction
- [ ] Final ranking
### Phase 6: Deliverables
- [ ] Ranked candidate list
- [ ] FASTA file with sequences
- [ ] Experimental recommendations
---
## Fallback Chains
| Primary Tool | Fallback 1 | Fallback 2 |
|--------------|------------|------------|
| `NvidiaNIM_rfdiffusion` | Manual backbone design | Scaffold from PDB |
| `NvidiaNIM_proteinmpnn` | Rosetta ProteinMPNN | Manual sequence design |
| `NvidiaNIM_esmfold` | `NvidiaNIM_alphafold2` | AlphaFold DB |
| PDB structure | `NvidiaNIM_alphafold2` | AlphaFold DB |
---
## Tool Reference
See [TOOLS_REFERENCE.md](TOOLS_REFERENCE.md) for complete tool documentation.Related Skills
tooluniverse
Router skill for ToolUniverse tasks. First checks if specialized tooluniverse skills (34+ skills covering disease/drug/target research, clinical decision support, genomics, epigenomics, chemical safety, systems biology, and more) can solve the problem, then falls back to general strategies for using 1400+ scientific tools. Covers tool discovery, multi-hop queries, comprehensive research workflows, disambiguation, evidence grading, and report generation. Use when users need to research any scientific topic, find biological data, or explore drug/target/disease relationships.
tooluniverse-variant-interpretation
Systematic clinical variant interpretation from raw variant calls to ACMG-classified recommendations with structural impact analysis. Aggregates evidence from ClinVar, gnomAD, CIViC, UniProt, and PDB across ACMG criteria. Produces pathogenicity scores (0-100), clinical recommendations, and treatment implications. Use when interpreting genetic variants, classifying variants of uncertain significance (VUS), performing ACMG variant classification, or translating variant calls to clinical actionability.
tooluniverse-variant-analysis
Production-ready VCF processing, variant annotation, mutation analysis, and structural variant (SV/CNV) interpretation for bioinformatics questions. Parses VCF files (streaming, large files), classifies mutation types (missense, nonsense, synonymous, frameshift, splice, intronic, intergenic) and structural variants (deletions, duplications, inversions, translocations), applies VAF/depth/quality/consequence filters, annotates with ClinVar/dbSNP/gnomAD/CADD via ToolUniverse, interprets SV/CNV clinical significance using ClinGen dosage sensitivity scores, computes variant statistics, and generates reports. Solves questions like "What fraction of variants with VAF < 0.3 are missense?", "How many non-reference variants remain after filtering intronic/intergenic?", "What is the pathogenicity of this deletion affecting BRCA1?", or "Which dosage-sensitive genes overlap this CNV?". Use when processing VCF files, annotating variants, filtering by VAF/depth/consequence, classifying mutations, interpreting structural variants, assessing CNV pathogenicity, comparing cohorts, or answering variant analysis questions.
tooluniverse-target-research
Gather comprehensive biological target intelligence from 9 parallel research paths covering protein info, structure, interactions, pathways, expression, variants, drug interactions, and literature. Features collision-aware searches, evidence grading (T1-T4), explicit Open Targets coverage, and mandatory completeness auditing. Use when users ask about drug targets, proteins, genes, or need target validation, druggability assessment, or comprehensive target profiling.
tooluniverse-systems-biology
Comprehensive systems biology and pathway analysis using multiple pathway databases (Reactome, KEGG, WikiPathways, Pathway Commons, BioModels). Performs pathway enrichment, protein-pathway mapping, keyword searches, and systems-level analysis. Use when analyzing gene sets, exploring biological pathways, or investigating systems-level biology.
tooluniverse-structural-variant-analysis
Comprehensive structural variant (SV) analysis skill for clinical genomics. Classifies SVs (deletions, duplications, inversions, translocations), assesses pathogenicity using ACMG-adapted criteria, evaluates gene disruption and dosage sensitivity, and provides clinical interpretation with evidence grading. Use when analyzing CNVs, large deletions/duplications, chromosomal rearrangements, or any structural variants requiring clinical interpretation.
tooluniverse-statistical-modeling
Perform statistical modeling and regression analysis on biomedical datasets. Supports linear regression, logistic regression (binary/ordinal/multinomial), mixed-effects models, Cox proportional hazards survival analysis, Kaplan-Meier estimation, and comprehensive model diagnostics. Extracts odds ratios, hazard ratios, confidence intervals, p-values, and effect sizes. Designed to solve BixBench statistical reasoning questions involving clinical/experimental data. Use when asked to fit regression models, compute odds ratios, perform survival analysis, run statistical tests, or interpret model coefficients from provided data.
tooluniverse-spatial-transcriptomics
Analyze spatial transcriptomics data to map gene expression in tissue architecture. Supports 10x Visium, MERFISH, seqFISH, Slide-seq, and imaging-based platforms. Performs spatial clustering, domain identification, cell-cell proximity analysis, spatial gene expression patterns, tissue architecture mapping, and integration with single-cell data. Use when analyzing spatial transcriptomics datasets, studying tissue organization, identifying spatial expression patterns, mapping cell-cell interactions in tissue context, characterizing tumor microenvironment spatial structure, or integrating spatial and single-cell RNA-seq data for comprehensive tissue analysis.
tooluniverse-spatial-omics-analysis
Computational analysis framework for spatial multi-omics data integration. Given spatially variable genes (SVGs), spatial domain annotations, tissue type, and disease context from spatial transcriptomics/proteomics experiments (10x Visium, MERFISH, DBiTplus, SLIDE-seq, etc.), performs comprehensive biological interpretation including pathway enrichment, cell-cell interaction inference, druggable target identification, immune microenvironment characterization, and multi-modal integration. Produces a detailed markdown report with Spatial Omics Integration Score (0-100), domain-by-domain characterization, and validation recommendations. Uses 70+ ToolUniverse tools across 9 analysis phases. Use when users ask about spatial transcriptomics analysis, spatial omics interpretation, tissue heterogeneity, spatial gene expression patterns, tumor microenvironment mapping, tissue zonation, or cell-cell communication from spatial data.
tooluniverse-single-cell
Production-ready single-cell and expression matrix analysis using scanpy, anndata, and scipy. Performs scRNA-seq QC, normalization, PCA, UMAP, Leiden/Louvain clustering, differential expression (Wilcoxon, t-test, DESeq2), cell type annotation, per-cell-type statistical analysis, gene-expression correlation, batch correction (Harmony), trajectory inference, and cell-cell communication analysis. NEW: Analyzes ligand-receptor interactions between cell types using OmniPath (CellPhoneDB, CellChatDB), scores communication strength, identifies signaling cascades, and handles multi-subunit receptor complexes. Integrates with ToolUniverse gene annotation tools (HPA, Ensembl, MyGene, UniProt) and enrichment tools (gseapy, PANTHER, STRING). Supports h5ad, 10X, CSV/TSV count matrices, and pre-annotated datasets. Use when analyzing single-cell RNA-seq data, studying cell-cell interactions, performing cell type differential expression, computing gene-expression correlations by cell type, analyzing tumor-immune communication, or answering questions about scRNA-seq datasets.
tooluniverse-sequence-retrieval
Retrieves biological sequences (DNA, RNA, protein) from NCBI and ENA with gene disambiguation, accession type handling, and comprehensive sequence profiles. Creates detailed reports with sequence metadata, cross-database references, and download options. Use when users need nucleotide sequences, protein sequences, genome data, or mention GenBank, RefSeq, EMBL accessions.
tooluniverse-sdk
Build AI scientist systems using ToolUniverse Python SDK for scientific research. Use when users need to access 1000++ scientific tools through Python code, create scientific workflows, perform drug discovery, protein analysis, genomics analysis, literature research, or any computational biology task. Triggers include requests to use scientific tools programmatically, build research pipelines, analyze biological data, search literature, predict drug properties, or create AI-powered scientific workflows.